Skip to Content

ELISA Recombinant Brucella abortus biovar 1 Phosphatidate cytidylyltransferase(cdsA)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Brucella abortus biovar 1 (strain 9-941) Uniprot NO.:P0C102 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MSNLQTRIITAIVLGTITLWLTWVGGVGFTLFSIAIGLAMFYEWTELSATRQTAFSRLFG WAWLIVTGILLILDRGALLTIGFLVAGCAILLVTQWKSGRGWPAAGLFYAGFSALSLSLL RGDEPFGFTTIVFLFAVVWSTDITAYFNGRALGGPKLAPRFSPNKTWSGAIGGAAAAVAG GLLVASLVAAPGGWGVPVLALLLSIVSQIGDLAESWVKRQFGAKDSGRLLPGHGGVLDRV DGLVAAAALLYLFGAIFAEPDVLSAIFFSF Protein Names:Recommended name: Phosphatidate cytidylyltransferase EC= 2.7.7.41 Alternative name(s): CDP-DAG synthase CDP-DG synthase CDP-diacylglycerol synthase Short name= CDS CDP-diglyceride pyrophosphorylase CDP-diglyceride syn Gene Names:Name:cdsA Ordered Locus Names:BruAb1_1163 Expression Region:1-270 Sequence Info:fµLl length protein
1.00 € 1.00 €

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days