Skip to Content

ELISA Recombinant Brucella abortus biovar 1 Lipoprotein signal peptidase(lspA)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Brucella abortus biovar 1 (strain 9-941) Uniprot NO.:Q57FM7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MKRHAVWSSLFVVILAVLIDQGIKYLVESRMFYGQQIDLLPFLALFRTHNEGIAFSmLAW LHDGGLIAITLAVIAFVLYLWWTNAPERVFARYGFALVIGGAIGNLIDRVMHGYVVDYVL FHLPTWSFAVFNLADAFITIGAGLIILEEFLGWRRERISH Protein Names:Recommended name: Lipoprotein signal peptidase EC= 3.4.23.36 Alternative name(s): Prolipoprotein signal peptidase Signal peptidase II Short name= SPase II Gene Names:Name:lspA Ordered Locus Names:BruAb1_0145 Expression Region:1-160 Sequence Info:fµLl length protein
1.00 € 1.00 €

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days