Skip to Content

ELISA Recombinant Brucella abortus biovar 1 Protein CrcB homolog 1(crcB1)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Brucella abortus biovar 1 (strain 9-941) Uniprot NO.:Q57CD7 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:mLDIIILVVIGGAFGAMTREFImLMVPPLTDGFPLDILVANVVACFLLGTVTALYARKIH SRDVHTIIGTGMMGGVSTFSSFAYGSVVLASASMSAFLIAAAYVTVSVVAGYVAVLAGMK FGEKSADILHRYPPMASIIDSGLVTVESRHSVAETIERVAAKAKSMGMNVFTRVDHGAGA KEAGLGLPPTELIIFGNPQNGTVLMQDKRTIGLDLPIRALAWEDGSGKVWLTVNDPAWLA QRHSLGLSSDVAIKAMVTGTGTVTKYAAGD Protein Names:Recommended name: Protein CrcB homolog 1 Gene Names:Name:crcB1 Ordered Locus Names:BruAb1_1366 Expression Region:1-270 Sequence Info:fµLl length protein
1.00 € 1.00 €

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days