Skip to Content

ELISA Recombinant Bovine ATP synthase lipid-binding protein, mitochondrial(ATP5G1)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:P32876 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:DIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEAM GLFCLMVAFLILFAM Protein Names:Recommended name: ATP synthase lipid-binding protein, mitochondrial Alternative name(s): ATP synthase proteolipid P1 ATPase protein 9 ATPase subunit c Gene Names:Name:ATP5G1 Expression Region:62-136 Sequence Info:FµLl length protein
1.00 € 1.00 €

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days