Skip to Content

ELISA Recombinant Bovine Melatonin receptor type 1A(MTNR1A)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:O02769 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:YPLALASIVNDGWSLSSLHCQLSGFLMGLSVIGSVFNITGIAINRYCCICHSLRYNKLYS STNSLCYVFLIWmLTLVAIVPNLCVGTLQYDPRIYSCTFTQSVSSAYTIAVVVFHFIVPM LVVIFCYLRIWALVLQVRWRVKPDNKPKLKPQDFRNFVTMFVVFVLFAICWAPLNFIGLV VASEPASMAPRIPEWLFVASYYMGYFNSCLNAIIYGLLNQNFRQEYRKIIVSLCTTKMFF VDSSNHVAHRIKRKPSP Protein Names:Recommended name: Melatonin receptor type 1A Short name= Mel-1A-R Short name= Mel1a receptor Gene Names:Name:MTNR1A Expression Region:1-257 Sequence Info:FµLl length protein
1.00 € 1.00 €

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days