Skip to Content

ELISA Recombinant Bovine Short transient receptor potential channel 2 homolog(TRPC2)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:O62826 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:MVILSLYLAAFTLRLLLAGLAHKHCRDAPDGAACHYFTSAERSEWRTEDPQFLAEVLFAV TSmLSFTRLASILPAHESLGTLQISMGRMIDDMIRFMFILMIILTAFLCGLNNIYVPYQE TERLGNFNETFQFLFWTMFGMEEHSVVDMPQFLVPEFVGRALYGIFTIVMVIVLLNmLIA MITNSFQKIEDAADVEWKFARSKLYLSYFREGLTLPVPFNILPSPKAIFYLLRRVFRFIC CCHFCCKTKKPDYPPIPTFANPGAGAGPGEGERGSYRLRVIKALVQRYIETAQREFEETR RKDLGNRLTELTKTVSRLQSEVAGVQRAVVEAGPRRPPGGASVLSRYITRVRNSFQNLGP PIPETPELTVPATVGTQESSEIGLPDAGGAQAPASGESGPSSPAHVLVHREQESEGAGDL PQEADLGAKEGT Protein Names:Recommended name: Short transient receptor potential channel 2 homolog Short name= TrpC2 Alternative name(s): Transient receptor protein 2 Short name= TRP-2 Short name= bTrp2 Gene Names:Name:TRPC2 Synonyms:TRP2 Expression Region:1-432 Sequence Info:FµLl length protein
1.00 € 1.00 €

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days