Skip to Content

ELISA Recombinant Bovine Uroplakin-1b(UPK1B)

Quantity:50 µg. Other Quantitys are also available. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:P38573 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:AKDDSTVRCFQGLLIFGNVIIGMCSIALMAECIFFVSDQNSLYPLLEATNNDDIYAAAWI GMFVGICLFCLSVLGIVGIMKSNRKILLVYFILMFIVYAFEVASCITAATQRDFFTPNLF LKQmLERYQNNSPPNNDDQWKNNGVTKTWDRLmLQDNCCGVNGPSDWQKYTSAFRTENSD ADYPWPRQCCVMNSLKEPLNLDACKLGVPGYYHSQGCYELISGPMNRHAWGVAWFGFAIL CWTFWVLLGTMFYWSRIDY Protein Names:Recommended name: Uroplakin-1b Short name= UP1b Alternative name(s): Uroplakin Ib Short name= UPIb Gene Names:Name:UPK1B Expression Region:2-260 Sequence Info:FµLl length protein
1.00 € 1.00 €

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days