Skip to Content

ELISA Recombinant Bovine ATP synthase subunit f, mitochondrial(ATP5J2)

Quantity:50 µg. Other Quantitys are also available. Please Inquire. Product Type:Recombinant Protein Species:Bos taurus (Bovine) Uniprot NO.:Q28851 Tag Info:The tag type will be determined during production process. Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃. Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week. AA Sequence:ASVVPLKEKKLLEVKLGELPSWILMRDFTPSGIAGAFQRGYYRYYNKYVNVKKGSIAGLS MVLAAYVFLNYCRSYKELKHERLRKYH Protein Names:Recommended name: ATP synthase subunit f, mitochondrial Gene Names:Name:ATP5J2 Expression Region:2-88 Sequence Info:fµLl length protein
1.00 € 1.00 €

Terms and Conditions
30-day money-back guarantee
Shipping: 2-3 Business Days